PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G04420.2
Common Nameanac048, NAC048, T27C4.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 340aa    MW: 38794.5 Da    PI: 5.0866
Description NAC domain containing protein 48
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G04420.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.92.6e-4241302128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  p+G+rF+Ptd+e+vv+yL++k ++++  ++++vi++v i +++Pw+Lp k+k ++++w fFs++++ky +g+++ r+tksgyWk tgk k++l+ +++
  AT3G04420.2   4 PVGLRFRPTDKEIVVDYLRPKNSDRDtSHVDRVISTVTIRSFDPWELPCKIKLKDESWCFFSPKENKYGRGDQQIRKTKSGYWKITGKPKPILR-NRQ 100
                  89*******************999984566678***************99999****************************************9.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  ++g kk+L+fy  ++  g+k+dWvmhey++
  AT3G04420.2 101 EIGEKKVLMFYMSKELGGSKSDWVMHEYHA 130
                  9***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-492148IPR003441NAC domain
PROSITE profilePS5100543.7233148IPR003441NAC domain
PfamPF023654.4E-224129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009047anatomystem
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MENPVGLRFR PTDKEIVVDY LRPKNSDRDT SHVDRVISTV TIRSFDPWEL PCKIKLKDES